PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca51261.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 388aa    MW: 43272.3 Da    PI: 9.3579
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca51261.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.51.1e-52141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+v+yL++kv+g++++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++
  Dca51261.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHQFSL-QIIAEIDLYKFDPWVLPSKAMFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT-QGRK 110
                 79***************************9.89***************8777899*************************************99.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+apkg+kt+W+mheyrl
  Dca51261.1 111 VGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-6710162IPR003441NAC domain
PROSITE profilePS5100560.64714162IPR003441NAC domain
PfamPF023653.7E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGVQEKDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGHQ FSLQIIAEID LYKFDPWVLP  60
SKAMFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTQGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLT EPTRKSGSSK LDDWVLCRIY KKSSGAVKPT TSKEHSTGGS  180
SSSSSSHLDD VLESLPDISG RSFALPRMNS LKNNNNVGPV QQNDKFNLQH HLGSGNFDWA  240
VLAGLTSVPE FGFVGSTQPQ SQSGQVNNNN NNNNNNNINN VSDMYVVPTL PPLSQVDSPV  300
DNKYWTPMVT DEEVQSGIRT QRLNNQNTGY YNSSTPAVHG YANSVDPFGI RYTNQQQSGY  360
GYGFRHLTKL VDDQGNGLDK KIFGLCES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_A1e-11011687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675611.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ93VY31e-130NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A088FQ490.0A0A088FQ49_9CARY; Putative NAC transcription factor
STRINGPOPTR_0011s12400.11e-151(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-118NAC family protein